CacheBy
Atlas Antibodies Anti-GNGT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNGT2 Antibody

상품 한눈에 보기

Human GNGT2 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성 제공. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043381-100 Anti-GNGT2 Antibody, guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043381-25 Anti-GNGT2 Antibody, guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNGT2 Antibody

Anti-GNGT2 Antibody

Target Protein: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2
Alternative Gene Names: GNG9

면역조직화학(IHC) 등 다양한 생명과학 연구 응용에 적합합니다.

Product Description

Polyclonal Antibody against Human GNGT2

Open Datasheet

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    EQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000006108 82%
Mouse ENSMUSG00000038811 82%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 실험 목적에 따라 사용자가 직접 확인해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.