
원본
Atlas Antibodies Anti-GNB1L Antibody
상품 한눈에 보기
휴먼 GNB1L 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현 검증)에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, 토끼 유래 IgG 형식입니다. 40% 글리세롤과 PBS 완충액에 보존되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034627-100 Anti-GNB1L Antibody, guanine nucleotide binding protein (G protein), beta polypeptide 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034627-25 Anti-GNB1L Antibody, guanine nucleotide binding protein (G protein), beta polypeptide 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GNB1L Antibody
Anti-GNB1L Antibody
Target: guanine nucleotide binding protein (G protein), beta polypeptide 1-like
Supplier: Atlas Antibodies
Host: Rabbit
Clonality: Polyclonal
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human GNB1L.
Alternative Gene Names
GY2, WDR14
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | guanine nucleotide binding protein (G protein), beta polypeptide 1-like |
| Target Gene | GNB1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000001891 (78%), Mouse ENSMUSG00000000884 (77%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



