Atlas Antibodies Anti-GMPR Antibody

상품 한눈에 보기

Human GMPR 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 WB(Recombinant Expression) 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공하며, 인체 유래 GMPR 연구에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021476-100 Anti-GMPR Antibody, guanosine monophosphate reductase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021476-25 Anti-GMPR Antibody, guanosine monophosphate reductase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GMPR Antibody

Anti-GMPR Antibody

Target: Guanosine monophosphate reductase (GMPR)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, Recombinant Expression)

Recombinant expression validation: 검증된 WB 실험에서 표적 단백질 과발현을 통해 확인됨.

Product Description

Polyclonal Antibody against Human GMPR
Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	Guanosine monophosphate reductase
Target Gene	GMPR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	DTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYS
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000017250 (91%), Mouse ENSMUSG00000000253 (88%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand