CacheBy
Atlas Antibodies Anti-GLRX3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLRX3 Antibody

상품 한눈에 보기

Human GLRX3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. GLRX3 유전자 연구 및 단백질 발현 분석에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028941-100 Anti-GLRX3 Antibody, glutaredoxin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028941-25 Anti-GLRX3 Antibody, glutaredoxin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLRX3 Antibody

Anti-GLRX3 Antibody

Target Information

  • Target Protein: glutaredoxin 3
  • Target Gene: GLRX3
  • Alternative Gene Names: bA500G10.4, GLRX4, GRX3, GRX4, PICOT, TXNL2

Product Description

Polyclonal antibody against human GLRX3.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    AEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000031068 94%
Rat ENSRNOG00000016227 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.