CacheBy
Atlas Antibodies Anti-GLIPR1L2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLIPR1L2 Antibody

상품 한눈에 보기

Human GLIPR1L2 단백질을 인식하는 rabbit polyclonal antibody로, IHC Orthogonal validation 완료. GLIPR1L2 관련 연구용에 적합하며, 고순도 affinity purification 방식으로 제조됨. Human에 대한 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039795-100 Anti-GLIPR1L2 Antibody, GLI pathogenesis-related 1 like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039795-25 Anti-GLIPR1L2 Antibody, GLI pathogenesis-related 1 like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLIPR1L2 Antibody

Anti-GLIPR1L2 Antibody

GLI pathogenesis-related 1 like 2


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human GLIPR1L2.


Alternative Gene Names

  • MGC39497

Open Datasheet


Target Information

항목 내용
Target Protein GLI pathogenesis-related 1 like 2
Target Gene GLIPR1L2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTAS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000049053 (75%)
  • Mouse ENSMUSG00000020214 (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.