
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GLIPR1L2 Antibody
상품 한눈에 보기
Human GLIPR1L2 단백질을 인식하는 rabbit polyclonal antibody로, IHC Orthogonal validation 완료. GLIPR1L2 관련 연구용에 적합하며, 고순도 affinity purification 방식으로 제조됨. Human에 대한 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039795-100 Anti-GLIPR1L2 Antibody, GLI pathogenesis-related 1 like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039795-25 Anti-GLIPR1L2 Antibody, GLI pathogenesis-related 1 like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GLIPR1L2 Antibody
Anti-GLIPR1L2 Antibody
GLI pathogenesis-related 1 like 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human GLIPR1L2.
Alternative Gene Names
- MGC39497
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GLI pathogenesis-related 1 like 2 |
| Target Gene | GLIPR1L2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTAS |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000049053 (75%)
- Mouse ENSMUSG00000020214 (69%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



