CacheBy
Atlas Antibodies Anti-GLB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLB1 Antibody

상품 한눈에 보기

Human GLB1 단백질에 대한 Rabbit Polyclonal 항체로, beta-galactosidase 인식. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040610-100 Anti-GLB1 Antibody, galactosidase, beta 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040610-25 Anti-GLB1 Antibody, galactosidase, beta 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLB1 Antibody

Anti-GLB1 Antibody

Target Information

  • Target Protein: galactosidase, beta 1
  • Target Gene: GLB1
  • Alternative Gene Names: EBP, ELNR1
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human GLB1 (galactosidase, beta 1).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000045594): 47%
  • Rat (ENSRNOG00000010196): 46%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Recommended Storage Store at -20°C. Avoid repeated freeze-thaw cycles.

Notes

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.