Atlas Antibodies Anti-GKN2 Antibody

상품 한눈에 보기

Human GKN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 교차 검증 완료. 고순도의 Affinity 정제 제품으로 인체 GKN2 연구에 적합. 다양한 조직 발현 비교 분석에 활용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057765-100 Anti-GKN2 Antibody, gastrokine 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057765-25 Anti-GKN2 Antibody, gastrokine 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: gastrokine 2 (GKN2)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human GKN2.

blottin, BRICD1B, GDDR, PRO813, TFIZ1, VLTI465

항목	내용
Target Protein	gastrokine 2
Target Gene	GKN2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENT
Verified Species Reactivity	Human
Interspecies Homology	Rat ENSRNOG00000009256 (65%), Mouse ENSMUSG00000030049 (59%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage / Handling	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.