CacheBy
Atlas Antibodies Anti-GK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GK Antibody

상품 한눈에 보기

Human GK 단백질을 인식하는 토끼 폴리클로날 항체. 글리세롤 키나아제 연구용으로 적합하며, IHC 등 다양한 응용에 사용 가능. 프레스티 항원으로 친화 정제되었으며, 40% 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060687-100 Anti-GK Antibody, glycerol kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060687-25 Anti-GK Antibody, glycerol kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GK Antibody

Anti-GK Antibody

Target Information

  • Target Protein: Glycerol kinase
  • Target Gene: GK
  • Alternative Gene Names: GK1, GKD

Product Description

Polyclonal antibody against human GK (Glycerol Kinase).

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IERLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000034116 (96%)
  • Mouse ENSMUSG00000025059 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.