AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GJB7 Antibody
상품 한눈에 보기
인간 GJB7(gap junction protein beta 7)을 인식하는 폴리클로날 항체. Rabbit 유래 IgG, PrEST 항원으로 친화 정제됨. 인간에 반응하며 ICC 등 다양한 응용에 적합. 40% glycerol 및 PBS buffer에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA014392-100 Anti-GJB7 Antibody, gap junction protein beta 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014392-25 Anti-GJB7 Antibody, gap junction protein beta 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GJB7 Antibody
Anti-GJB7 Antibody
Target Information
- Target Protein: Gap junction protein beta 7
- Target Gene: GJB7
- Alternative Gene Names: bA136M9.1, CX25
Product Description
Polyclonal antibody against human GJB7.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:YKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFI
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000008847 (68%)
- Mouse ENSMUSG00000048582 (68%)
Recommended Applications
ICC (Immunocytochemistry)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
Open Datasheet (PDF)
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.