CacheBy
Atlas Antibodies Anti-GINS4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GINS4 Antibody

상품 한눈에 보기

인간 GINS4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 재조합 단백질 발현 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 다양한 종 교차 반응성 정보 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024663-100 Anti-GINS4 Antibody, GINS complex subunit 4 (Sld5 homolog) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024663-25 Anti-GINS4 Antibody, GINS complex subunit 4 (Sld5 homolog) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GINS4 Antibody

Anti-GINS4 Antibody

GINS complex subunit 4 (Sld5 homolog)

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    • Recombinant expression validation in WB using target protein overexpression.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human GINS4

Alternative Gene Names

MGC14799, SLD5

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein GINS complex subunit 4 (Sld5 homolog)
Target Gene GINS4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000018040 (89%), Mouse ENSMUSG00000031546 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.