CacheBy
Atlas Antibodies Anti-GIF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GIF Antibody

상품 한눈에 보기

Human GIF 단백질을 인식하는 토끼 폴리클로날 항체로, 위 내인성 인자 단백질 연구에 적합합니다. IHC 및 WB에 검증된 항체로 정제된 PrEST 항원을 사용해 제작되었습니다. 비타민 B 대사 관련 연구 및 단백질 발현 분석에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039908-100 Anti-GIF Antibody, gastric intrinsic factor (vitamin B synthesis) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039908-25 Anti-GIF Antibody, gastric intrinsic factor (vitamin B synthesis) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GIF Antibody

Anti-GIF Antibody

Target: Gastric intrinsic factor (vitamin B synthesis)
Supplier: Atlas Antibodies


  • Orthogonal validation (IHC): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
  • Recombinant expression validation (WB): Validation performed using target protein overexpression.

Product Description

Polyclonal antibody against Human GIF.


Alternative Gene Names

IF, IFMH, INF, TCN3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Gastric intrinsic factor (vitamin B synthesis)
Target Gene GIF
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000024682 (79%), Rat ENSRNOG00000021001 (78%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.