Atlas Antibodies Anti-GHR Antibody

상품 한눈에 보기

Human GHR 타깃의 폴리클로날 항체로, IHC와 RNA-seq 데이터 비교를 통한 Orthogonal 검증 제공. Rabbit 유래 IgG로 PrEST 항원 기반 친화 정제. 인간 반응성이 검증된 성장호르몬 수용체 연구용 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045339-100 Anti-GHR Antibody, growth hormone receptor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045339-25 Anti-GHR Antibody, growth hormone receptor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Growth Hormone Receptor (GHR)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human GHR

항목	내용
Target Protein	Growth Hormone Receptor
Target Gene	GHR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000015654 (68%), Mouse ENSMUSG00000055737 (66%)

Antigen Sequence:
NWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQF

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand