AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GFOD2 Antibody
상품 한눈에 보기
Human GFOD2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 고유한 항원 서열 기반으로 높은 특이성과 재현성을 제공. 글리세롤 기반 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041112-100 Anti-GFOD2 Antibody, glucose-fructose oxidoreductase domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041112-25 Anti-GFOD2 Antibody, glucose-fructose oxidoreductase domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GFOD2 Antibody
Anti-GFOD2 Antibody
Target: glucose-fructose oxidoreductase domain containing 2 (GFOD2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human GFOD2.
Alternative Gene Names: FLJ23802, MGC11335
Datasheet: Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glucose-fructose oxidoreductase domain containing 2 |
| Target Gene | GFOD2 |
| Antigen Sequence | PVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Species Reactivity
- Verified Species: Human
- Ortholog Sequence Identity:
- Rat ENSRNOG00000017953 (91%)
- Mouse ENSMUSG00000013150 (89%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 설명 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.