CacheBy
Atlas Antibodies Anti-TSKS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TSKS Antibody

상품 한눈에 보기

Human TSKS 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 단백질 발현 확인에 적합합니다. Rabbit 호스트에서 생산되었으며, 고순도 Affinity 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045729-100 Anti-TSKS Antibody, testis-specific serine kinase substrate 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045729-25 Anti-TSKS Antibody, testis-specific serine kinase substrate 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TSKS Antibody

Anti-TSKS Antibody

Target: Testis-specific serine kinase substrate (TSKS)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human TSKS


Alternative Gene Names

PPP1R161, TSSKS

Open Datasheet (PDF)


Antigen Information

항목 내용
Target Protein Testis-specific serine kinase substrate
Target Gene TSKS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDEALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGT

Species Reactivity

Verified: Human

Interspecies Information:

  • Mouse ENSMUSG00000059891 (89%)
  • Rat ENSRNOG00000020443 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.