CacheBy
Atlas Antibodies Anti-TSC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TSC2 Antibody

상품 한눈에 보기

Human TSC2 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC 등 다양한 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 반응성을 보입니다. 연구용으로 사용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030409-100 Anti-TSC2 Antibody, tuberous sclerosis 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030409-25 Anti-TSC2 Antibody, tuberous sclerosis 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TSC2 Antibody

Anti-TSC2 Antibody

Target Information

  • Target Protein: tuberous sclerosis 2
  • Target Gene: TSC2
  • Alternative Gene Names: LAM, PPP1R160, TSC4, tuberin
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TSC2 protein.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000011375 93%
Mouse ENSMUSG00000002496 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.