CacheBy
Atlas Antibodies Anti-TRPV6 Antibody
원본

Atlas Antibodies Anti-TRPV6 Antibody

상품 한눈에 보기

Human TRPV6 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합. Affinity purification 방식으로 높은 특이성과 재현성을 제공. Human에 대해 검증된 반응성을 가지며, TRPV6 관련 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062864-100 Anti-TRPV6 Antibody, transient receptor potential cation channel, subfamily V, member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062864-25 Anti-TRPV6 Antibody, transient receptor potential cation channel, subfamily V, member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRPV6 Antibody

Anti-TRPV6 Antibody

Target: Transient receptor potential cation channel, subfamily V, member 6 (TRPV6)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human TRPV6.

Alternative Gene Names

  • CaT1
  • ECAC2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Transient receptor potential cation channel, subfamily V, member 6
Target Gene TRPV6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence Detail SPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQ
Verified Species Reactivity Human
Interspecies Identity Mouse (82%), Rat (80%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.