
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRPS1 Antibody
상품 한눈에 보기
인체 TRPS1 단백질을 인식하는 폴리클로날 항체로, ICC 등 다양한 응용에 적합함. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. Human에 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA060380-100 Anti-TRPS1 Antibody, trichorhinophalangeal syndrome I 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060380-25 Anti-TRPS1 Antibody, trichorhinophalangeal syndrome I 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRPS1 Antibody
Anti-TRPS1 Antibody
Target Information
- Target Protein: trichorhinophalangeal syndrome I
- Target Gene: TRPS1
- Alternative Gene Names: GC79, LGCR
Product Description
Polyclonal antibody against Human TRPS1.
Recommended Applications
이미지 내 텍스트: ICC (Immunocytochemistry)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
SPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000038679 | 99% |
| Rat | ENSRNOG00000024998 | 99% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Description |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



