Atlas Antibodies Anti-TRPM1 Antibody

상품 한눈에 보기

인간 TRPM1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. TRPM1 관련 연구 및 단백질 발현 분석에 유용합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA014779-100 Anti-TRPM1 Antibody, transient receptor potential cation channel, subfamily M, member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA014779-25 Anti-TRPM1 Antibody, transient receptor potential cation channel, subfamily M, member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TRPM1 Antibody

Anti-TRPM1 Antibody

Target: transient receptor potential cation channel, subfamily M, member 1 (TRPM1)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
(이미지 내 텍스트: IHC)

Product Description

Polyclonal antibody against human TRPM1.

Alternative Gene Names

CSNB1C
LTRPC1
MLSN1

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	transient receptor potential cation channel, subfamily M, member 1
Target Gene	TRPM1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (AA)	CEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDD

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|----------|----------|-----------|
| Rat | ENSRNOG00000015829 | 65% |
| Mouse | ENSMUSG00000030523 | 61% |