CacheBy
Atlas Antibodies Anti-TRNAU1AP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRNAU1AP Antibody

상품 한눈에 보기

Human TRNAU1AP 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며, Human, Rat, Mouse 종에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA032069-100 Anti-TRNAU1AP Antibody, tRNA selenocysteine 1 associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA032069-25 Anti-TRNAU1AP Antibody, tRNA selenocysteine 1 associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRNAU1AP Antibody

Anti-TRNAU1AP Antibody

Target Information

  • Target Protein: tRNA selenocysteine 1 associated protein 1
  • Target Gene: TRNAU1AP
  • Alternative Gene Names: FLJ20503, SECP43, TRSPAP1

Product Description

Polyclonal Antibody against Human TRNAU1AP.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

WMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000055344 (100%)
  • Mouse ENSMUSG00000028898 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand
  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.