CacheBy
Atlas Antibodies Anti-TRMT13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRMT13 Antibody

상품 한눈에 보기

Human TRMT13 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 WB에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성(마우스 85%, 랫 84%)을 보임. 40% glycerol 기반 PBS buffer에 sodium azide 보존제가 포함됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028494-100 Anti-TRMT13 Antibody, tRNA methyltransferase 13 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028494-25 Anti-TRMT13 Antibody, tRNA methyltransferase 13 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRMT13 Antibody

Anti-TRMT13 Antibody

Target: tRNA methyltransferase 13 homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human TRMT13

Alternative Gene Names

CCDC76, FLJ10287, FLJ11219

Open Datasheet

Target Information

항목 내용
Target Protein tRNA methyltransferase 13 homolog (S. cerevisiae)
Target Gene TRMT13
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (85%), Rat (84%)

Antigen Sequence:
NSVFERLQIDIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIAL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.