CacheBy
Atlas Antibodies Anti-TRMT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRMT1 Antibody

상품 한눈에 보기

Human TRMT1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 보존성을 가지며 안정적인 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041380-100 Anti-TRMT1 Antibody, tRNA methyltransferase 1 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041380-25 Anti-TRMT1 Antibody, tRNA methyltransferase 1 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRMT1 Antibody

Anti-TRMT1 Antibody

Target Information

  • Target Protein: tRNA methyltransferase 1 homolog (S. cerevisiae)
  • Target Gene: TRMT1
  • Alternative Gene Names: FLJ20244, TRM1
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human TRMT1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000001909 92%
Rat ENSRNOG00000002914 91%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.