
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRIP13 Antibody
상품 한눈에 보기
Human TRIP13 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Recombinant Expression 검증 완료. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA053093-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053093-100 Anti-TRIP13 Antibody, thyroid hormone receptor interactor 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053093-25 Anti-TRIP13 Antibody, thyroid hormone receptor interactor 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRIP13 Antibody
Anti-TRIP13 Antibody
Target: thyroid hormone receptor interactor 13 (TRIP13)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 검증
- WB (Recombinant Expression Validation): 표적 단백질 과발현을 통한 Western blot 검증
- ICC: 세포 내 단백질 발현 분석에 활용 가능
Product Description
Polyclonal antibody against Human TRIP13
Alternative Gene Names
- 16E1BP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | thyroid hormone receptor interactor 13 |
| Target Gene | TRIP13 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | STAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLVYDVEVKSH |
Species Reactivity
- Verified: Human
Interspecies Information:
- Rat ENSRNOG00000015810 (89%)
- Mouse ENSMUSG00000021569 (88%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative 포함.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 실험 조건은 사용자에 의해 결정되어야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



