CacheBy
Atlas Antibodies Anti-TRIM9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRIM9 Antibody

상품 한눈에 보기

Human TRIM9 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합. RNF91, SPRING 대체 유전자명으로도 알려짐. 고순도 Affinity purification 방식으로 제조되어 높은 특이성과 재현성을 제공. Human, Mouse, Rat에 100% 반응성 확인.

카탈로그번호
HPA041489-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041489-100 Anti-TRIM9 Antibody, tripartite motif containing 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041489-25 Anti-TRIM9 Antibody, tripartite motif containing 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRIM9 Antibody

Anti-TRIM9 Antibody

Target Information

  • Target Protein: tripartite motif containing 9
  • Target Gene: TRIM9
  • Alternative Gene Names: RNF91, SPRING

Product Description

Polyclonal Antibody against Human TRIM9

  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    QCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000021071): 100%
  • Rat (ENSRNOG00000007031): 100%

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.