Atlas Antibodies Anti-TRIM6 Antibody

상품 한눈에 보기

Human TRIM6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, 인체 반응성이 검증됨. RNF89로도 알려진 TRIM6 단백질 연구에 활용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA060514-100 Anti-TRIM6 Antibody, tripartite motif containing 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA060514-25 Anti-TRIM6 Antibody, tripartite motif containing 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human TRIM6 protein.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Immunohistochemistry (IHC)

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VQSYWVDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFS

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use. Determine optimal concentrations and conditions experimentally.