AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRIM32 Antibody
상품 한눈에 보기
인간 TRIM32 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. BBS11, LGMD2H 등 대체 유전자명으로도 알려짐.
- 카탈로그번호
- HPA050060-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050060-100 Anti-TRIM32 Antibody, tripartite motif containing 32 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050060-25 Anti-TRIM32 Antibody, tripartite motif containing 32 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRIM32 Antibody
Anti-TRIM32 Antibody
Target Information
- Target Protein: Tripartite motif containing 32
- Target Gene: TRIM32
- Alternative Gene Names: BBS11, HT2A, LGMD2H, TATIP
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human TRIM32, generated in rabbit.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
NLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDA
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Rat ENSRNOG00000010303 (98%)
- Mouse ENSMUSG00000051675 (97%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Open Datasheet (PDF)
Material Safety Data Sheet (Sodium Azide)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.