CacheBy
Atlas Antibodies Anti-TRIM31 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRIM31 Antibody

상품 한눈에 보기

인간 TRIM31 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 오쏘고날 검증에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, RNA-seq 데이터 기반 단백질 발현 비교 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074175-100 Anti-TRIM31 Antibody, tripartite motif containing 31 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074175-25 Anti-TRIM31 Antibody, tripartite motif containing 31 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRIM31 Antibody

Anti-TRIM31 Antibody

Target: tripartite motif containing 31 (TRIM31)
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC
    (Comparison to RNA-seq data of corresponding target in high and low expression tissues)

Product Description

Polyclonal antibody against human TRIM31.


Alternative Gene Names

C6orf13, HCG1, HCGI, RNF

Open Datasheet


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ESKDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQRILTEFELLHQVLEEEKNFLLS

Species Reactivity

Category Description
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to orthologs:
Mouse ENSMUSG00000058063 (55%)
Rat ENSRNOG00000021518 (49%)

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.