CacheBy
Atlas Antibodies Anti-TRIM27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRIM27 Antibody

상품 한눈에 보기

Human TRIM27 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제됨. RFP, RNF76 등 대체 유전자명과 높은 종간 서열 동일성 보유.

카탈로그번호
HPA048684-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048684-100 Anti-TRIM27 Antibody, tripartite motif containing 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048684-25 Anti-TRIM27 Antibody, tripartite motif containing 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRIM27 Antibody

Anti-TRIM27 Antibody

Target: tripartite motif containing 27 (TRIM27)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TRIM27.


Alternative Gene Names

  • RFP
  • RNF76

Open Datasheet


Target Information

  • Target Protein: tripartite motif containing 27
  • Target Gene: TRIM27
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    VEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000055917 97%
Mouse ENSMUSG00000021326 97%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.