Atlas Antibodies Anti-TREX1 Antibody

상품 한눈에 보기

Human TREX1 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 연구용 응용에 적합함. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human에 대한 반응성이 검증되어 신뢰성 높은 데이터 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046721-100 Anti-TREX1 Antibody, three prime repair exonuclease 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046721-25 Anti-TREX1 Antibody, three prime repair exonuclease 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: three prime repair exonuclease 1 (TREX1)
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Polyclonal antibody against human TREX1.

AGS1, DRN3

Target Protein: three prime repair exonuclease 1
Target Gene: TREX1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
PPPTVPPPPRVVDKLSLCVAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYD
```

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand