CacheBy
Atlas Antibodies Anti-TRDMT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRDMT1 Antibody

상품 한눈에 보기

Human TRDMT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. DNMT2/RNMT1 대체명으로 알려진 tRNA 아스파르트산 메틸트랜스퍼라제1을 타깃. PrEST 항원으로 친화 정제되었으며, PBS/glycerol buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036945-100 Anti-TRDMT1 Antibody, tRNA aspartic acid methyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036945-25 Anti-TRDMT1 Antibody, tRNA aspartic acid methyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRDMT1 Antibody

Anti-TRDMT1 Antibody

Target: tRNA aspartic acid methyltransferase 1
Supplier: Atlas Antibodies
Catalog: HPA036945


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human TRDMT1 (tRNA aspartic acid methyltransferase 1).
Also known as DNMT2 or RNMT1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein tRNA aspartic acid methyltransferase 1
Target Gene TRDMT1
Alternative Gene Names DNMT2, RNMT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRT
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026723 (87%)
Rat ENSRNOG00000026132 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.