CacheBy
Atlas Antibodies Anti-TRAPPC8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRAPPC8 Antibody

상품 한눈에 보기

인간 TRAPPC8 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 ICC 실험에 적합하며, PrEST 항원으로 특이적 친화 정제되었습니다. 인간에 대한 검증된 반응성과 높은 종간 상동성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041107-100 Anti-TRAPPC8 Antibody, trafficking protein particle complex 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041107-25 Anti-TRAPPC8 Antibody, trafficking protein particle complex 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRAPPC8 Antibody

Anti-TRAPPC8 Antibody

Target: Trafficking protein particle complex 8
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TRAPPC8.

Alternative Gene Names

GSG1, HsT2706, KIAA1012, TRS85

Open Datasheet

Target Information

  • Target Protein: Trafficking protein particle complex 8
  • Target Gene: TRAPPC8

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DYDLNISATTPWFESYRETFLQSMPASDHEFLNHYLACMLVASSSEAEPVEQFSKLSQEQHRIQHNSDYSYPKWFIPNTLKYYVLLHDVSAGDE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000022202 (96%)
  • Mouse ENSMUSG00000033382 (95%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.