CacheBy
Atlas Antibodies Anti-TRAPPC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRAPPC2 Antibody

상품 한눈에 보기

Human TRAPPC2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, Human, Rat, Mouse에 99% 동일한 항원 서열을 가집니다. ICC 등 다양한 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063308-100 Anti-TRAPPC2 Antibody, trafficking protein particle complex 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063308-25 Anti-TRAPPC2 Antibody, trafficking protein particle complex 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRAPPC2 Antibody

Anti-TRAPPC2 Antibody

Target Information

  • Target Protein: Trafficking protein particle complex 2
  • Target Gene: TRAPPC2
  • Alternative Gene Names: hYP38334, MIP-2A, SEDL, SEDT, TRS20, ZNF547L

Product Description

Polyclonal antibody against Human TRAPPC2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat: ENSRNOG00000042276 (99%)
  • Mouse: ENSMUSG00000079317 (99%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications ICC (Immunocytochemistry)

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.