CacheBy
Atlas Antibodies Anti-TPT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TPT1 Antibody

상품 한눈에 보기

Human TPT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. fortilin/TCTP로도 알려진 TPT1 검출용. PrEST 항원을 이용해 친화 정제됨. Human 반응성 검증 완료.

카탈로그번호
HPA039437-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039437-100 Anti-TPT1 Antibody, tumor protein, translationally-controlled 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039437-25 Anti-TPT1 Antibody, tumor protein, translationally-controlled 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TPT1 Antibody

Anti-TPT1 Antibody

Target: tumor protein, translationally-controlled 1 (TPT1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TPT1.


Alternative Gene Names

  • fortilin
  • TCTP

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein tumor protein, translationally-controlled 1
Target Gene TPT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYM
Verified Species Reactivity Human
Ortholog Identity Mouse ENSMUSG00000060126 (97%), Rat ENSRNOG00000001049 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.