AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TP53TG5 Antibody
상품 한눈에 보기
Human TP53TG5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 기반 Orthogonal 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, RNA-seq 데이터 비교를 통한 단백질 발현 검증. 다양한 조직 분석 연구에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058510-100 Anti-TP53TG5 Antibody, TP53 target 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058510-25 Anti-TP53TG5 Antibody, TP53 target 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TP53TG5 Antibody
Anti-TP53TG5 Antibody
Target: TP53 target 5
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human TP53TG5
Alternative Gene Names
C20orf10, CLG01, dJ453C12.5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | TP53 target 5 |
| Target Gene | TP53TG5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SSLLKLLKSSNHRIQELHKLAKRCWHSLLSVPKILRISSGENSACNKTKQNNEEFQEIGCSEKELKSKKL |
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Mouse (ENSMUSG00000017720) – 63%
- Rat (ENSRNOG00000026215) – 57%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.