CacheBy
Atlas Antibodies Anti-TOGARAM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TOGARAM1 Antibody

상품 한눈에 보기

인간 TOGARAM1 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성 보유. PBS와 글리세롤 기반 완충액에 보존제 포함.

카탈로그번호
HPA050849-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050849-100 Anti-TOGARAM1 Antibody, TOG array regulator of axonemal microtubules 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050849-25 Anti-TOGARAM1 Antibody, TOG array regulator of axonemal microtubules 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TOGARAM1 Antibody

Anti-TOGARAM1 Antibody

Target: TOG array regulator of axonemal microtubules 1 (TOGARAM1)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TOGARAM1.


Alternative Gene Names

crescerin, Crescerin-1, FAM179B, KIAA0423

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:

DTDWLLAGNRTQSAHCHCGDHVRDSMHIYGSYSPTICTRRVLSAGKGKNKLPWENEQPGIMGENQTSTSKDIEQFSTYDFIPSAKLKLSQGMPVNDDLCFS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000004415 85%
Mouse ENSMUSG00000035614 83%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using PrEST antigen as affinity ligand
Preservative Sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.