CacheBy
Atlas Antibodies Anti-TNFSF12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TNFSF12 Antibody

상품 한눈에 보기

인간 TNFSF12 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며 PrEST 항원으로 친화 정제됨. Human에 특이적 반응성을 검증받았으며 안정한 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052967-100 Anti-TNFSF12 Antibody, tumor necrosis factor (ligand) superfamily, member 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052967-25 Anti-TNFSF12 Antibody, tumor necrosis factor (ligand) superfamily, member 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TNFSF12 Antibody

Anti-TNFSF12 Antibody

Tumor necrosis factor (ligand) superfamily, member 12

면역조직화학(IHC)

Product Description

Polyclonal Antibody against Human TNFSF12

Alternative Gene Names

APO3L, DR3LG, TWEAK

Open Datasheet

Target Information

항목 내용
Target Protein Tumor necrosis factor (ligand) superfamily, member 12
Target Gene TNFSF12
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000018752 (84%), Rat ENSRNOG00000045670 (81%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYC

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.