
원본
Atlas Antibodies Anti-TNFAIP6 Antibody
상품 한눈에 보기
Human TNFAIP6 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 WB 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Orthogonal validation으로 검증되었습니다. Human에 대한 반응성이 확인되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050884-100 Anti-TNFAIP6 Antibody, tumor necrosis factor, alpha-induced protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050884-25 Anti-TNFAIP6 Antibody, tumor necrosis factor, alpha-induced protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TNFAIP6 Antibody
Anti-TNFAIP6 Antibody
Tumor necrosis factor, alpha-induced protein 6
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human TNFAIP6
Alternative Gene Names
TSG-6, TSG6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Tumor necrosis factor, alpha-induced protein 6 |
| Target Gene | TNFAIP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQ |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000053475 (93%), Rat ENSRNOG00000050792 (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



