원본

Atlas Antibodies Anti-TNFAIP6 Antibody

상품 한눈에 보기

Human TNFAIP6 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 WB 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Orthogonal validation으로 검증되었습니다. Human에 대한 반응성이 확인되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

ADBIX 2026 전시회10/28~30 코엑스 · 사전등록 안내자세히보기

Atlas Antibodies HPA050884-100 Anti-TNFAIP6 Antibody, tumor necrosis factor, alpha-induced protein 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050884-25 Anti-TNFAIP6 Antibody, tumor necrosis factor, alpha-induced protein 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TNFAIP6 Antibody

Anti-TNFAIP6 Antibody

Tumor necrosis factor, alpha-induced protein 6

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against Human TNFAIP6

Alternative Gene Names

TSG-6, TSG6

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	Tumor necrosis factor, alpha-induced protein 6
Target Gene	TNFAIP6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	DDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQ
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000053475 (93%), Rat ENSRNOG00000050792 (90%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand