CacheBy
Atlas Antibodies Anti-GDAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GDAP1 Antibody

상품 한눈에 보기

인간 GDAP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용한 친화정제 방식으로 높은 특이성과 재현성 제공. 인간에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014266-100 Anti-GDAP1 Antibody, ganglioside induced differentiation associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014266-25 Anti-GDAP1 Antibody, ganglioside induced differentiation associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GDAP1 Antibody

Anti-GDAP1 Antibody

Target: ganglioside induced differentiation associated protein 1 (GDAP1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GDAP1.


Alternative Gene Names

  • CMT4
  • CMT4A

Open Datasheet


Target Information

항목 내용
Target Protein ganglioside induced differentiation associated protein 1
Target Gene GDAP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYY

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Rat ENSRNOG00000005850 97%
Mouse ENSMUSG00000025777 93%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.