CacheBy
Atlas Antibodies Anti-GBP6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GBP6 Antibody

상품 한눈에 보기

인간 GBP6 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. PrEST 항원으로 특이적 정제. 다양한 조직 및 세포주에서 단백질 발현 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027744-100 Anti-GBP6 Antibody, guanylate binding protein family, member 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027744-25 Anti-GBP6 Antibody, guanylate binding protein family, member 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GBP6 Antibody

Anti-GBP6 Antibody

Target: guanylate binding protein family, member 6 (GBP6)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human GBP6


Alternative Gene Names

  • DKFZp686G0786

Open Datasheet


Target Information

항목 내용
Target Protein guanylate binding protein family, member 6
Target Gene GBP6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000040253 (41%), Rat ENSRNOG00000029191 (40%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.