CacheBy
Atlas Antibodies Anti-GBP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GBP2 Antibody

상품 한눈에 보기

인간 GBP2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 특이적 정제되었습니다. 인간에 대한 반응성이 검증되어 신뢰성 높은 연구용 시약입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042682-100 Anti-GBP2 Antibody, guanylate binding protein 2, interferon-inducible 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042682-25 Anti-GBP2 Antibody, guanylate binding protein 2, interferon-inducible 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GBP2 Antibody

Anti-GBP2 Antibody

Target: Guanylate Binding Protein 2, Interferon-Inducible
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human GBP2.
Open Datasheet


Target Information

  • Target Protein: Guanylate Binding Protein 2, Interferon-Inducible
  • Target Gene: GBP2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000028270 47%
Rat ENSRNOG00000002903 39%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.