CacheBy
Atlas Antibodies Anti-GBE1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GBE1 Antibody

상품 한눈에 보기

인간 GBE1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, WB, IHC, ICC 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. RNA-seq 및 독립 항체 비교를 통한 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038074-100 Anti-GBE1 Antibody, glucan (1,4-alpha-), branching enzyme 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038074-25 Anti-GBE1 Antibody, glucan (1,4-alpha-), branching enzyme 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GBE1 Antibody

Anti-GBE1 Antibody

Target Information

  • Protein: glucan (1,4-alpha-), branching enzyme 1
  • Gene: GBE1
  • Species Reactivity: Human

Product Description

Polyclonal antibody against human GBE1.
Validated for use in WB, IHC, and ICC applications.
Orthogonal and independent validation ensure reliable protein expression detection.

Validation Information

  • Orthogonal Validation: Comparison of IHC results with RNA-seq data in tissues showing high and low expression levels.
  • Independent Validation: Western blot validation using independent antibodies targeting different epitopes of GBE1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMY

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022707 95%
Rat ENSRNOG00000051232 69%

Technical Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Independent Validation
Independent Tooltip
ICC Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.