AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GATA5 Antibody
상품 한눈에 보기
인간 GATA5 단백질을 인식하는 토끼 폴리클로날 항체입니다. 면역세포화학(ICC) 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 글리세롤 기반 완충액에 보존되어 안정성이 우수합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067583-100 Anti-GATA5 Antibody, GATA binding protein 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067583-25 Anti-GATA5 Antibody, GATA binding protein 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GATA5 Antibody
Anti-GATA5 Antibody
Target: GATA binding protein 5
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human GATA5.
Alternative Gene Names
- bB379O24.1
- GATAS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GATA binding protein 5 |
| Target Gene | GATA5 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | GTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRE |
Species Reactivity
- Verified Species: Human
- Interspecies Information:
- Rat ENSRNOG00000058983 (72%)
- Mouse ENSMUSG00000015627 (67%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.