Atlas Antibodies Anti-GAS8 Antibody

상품 한눈에 보기

Human GAS8 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 정제됨. 높은 종간 반응성(96% Rat, Mouse) 확인. 안정적인 PBS/glycerol buffer에 보존.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048238-100 Anti-GAS8 Antibody, growth arrest-specific 8 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048238-25 Anti-GAS8 Antibody, growth arrest-specific 8 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GAS8 Antibody

Anti-GAS8 Antibody

Target: growth arrest-specific 8 (GAS8)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal antibody against human GAS8 protein.

Alternative Gene Names

GAS11

Open Datasheet (PDF)

Target Information

Target Protein: growth arrest-specific 8
Target Gene: GAS8
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VEKKEVQFNEVLAASNLDPAALTLVSRKLEDVLESKNSTIKDLQYELAQVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat: ENSRNOG00000026964 (96%)
Mouse: ENSMUSG00000040220 (96%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.