Atlas Antibodies Anti-GAS7 Antibody

상품 한눈에 보기

Human GAS7 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 신뢰성 확보. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Rabbit IgG 포맷으로 다양한 연구 응용에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA064678-100 Anti-GAS7 Antibody, growth arrest-specific 7 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA064678-25 Anti-GAS7 Antibody, growth arrest-specific 7 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: growth arrest-specific 7 (GAS7)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant expression validation): Validation using recombinant target protein overexpression.

Polyclonal antibody against Human GAS7.

Antigen Sequence (Recombinant PrEST Epitope):

KQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFS

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000049361	98%
Mouse	ENSMUSG00000033066	98%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand