CacheBy
Atlas Antibodies Anti-GAS6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GAS6 Antibody

상품 한눈에 보기

Human GAS6 단백질을 인식하는 고품질 Rabbit Polyclonal Antibody. IHC 등 다양한 연구 응용에 적합. PrEST 항원으로 특이적 친화 정제. 인간 반응성 검증 완료. 안정한 PBS/glycerol buffer로 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008275-100 Anti-GAS6 Antibody, growth arrest-specific 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008275-25 Anti-GAS6 Antibody, growth arrest-specific 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GAS6 Antibody

Anti-GAS6 Antibody

Target Protein: growth arrest-specific 6 (GAS6)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human GAS6.


Alternative Gene Names

AXLLG, AXSF, DKFZp666G247, FLJ34709

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein growth arrest-specific 6
Target Gene GAS6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (79%), Mouse (76%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTS

Notes


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.