
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GARNL3 Antibody
상품 한눈에 보기
인간 GARNL3 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합합니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. 인간 반응성이 검증되었으며, 마우스 및 랫트에서 높은 서열 유사성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA074886-100 Anti-GARNL3 Antibody, GTPase activating Rap/RanGAP domain like 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074886-25 Anti-GARNL3 Antibody, GTPase activating Rap/RanGAP domain like 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GARNL3 Antibody
Anti-GARNL3 Antibody
GTPase activating Rap/RanGAP domain-like 3
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human GARNL3.
Alternative Gene Names
- bA356B19.1
- DKFZp761J1523
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GTPase activating Rap/RanGAP domain-like 3 |
| Target Gene | GARNL3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000038860 (94%), Rat ENSRNOG00000057044 (94%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence:
LVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSNotes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



