CacheBy
Atlas Antibodies Anti-GAPDHS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GAPDHS Antibody

상품 한눈에 보기

Human GAPDHS 단백질을 인식하는 토끼 다클론 항체. IHC 및 ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용하여 친화도 정제됨. RNA-seq 데이터 기반의 직교 검증 완료. 40% 글리세롤 및 PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042666-100 Anti-GAPDHS Antibody, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042666-25 Anti-GAPDHS Antibody, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GAPDHS Antibody

Anti-GAPDHS Antibody

Target: glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) — Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human GAPDHS.


Alternative Gene Names

GAPD2, GAPDH-2, GAPDS


Target Information

항목 내용
Target Protein glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
Target Gene GAPDHS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000061099 (75%), Rat ENSRNOG00000021009 (75%)

Epitope Sequence:
KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.