
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GAPDHS Antibody
상품 한눈에 보기
Human GAPDHS 단백질을 인식하는 토끼 다클론 항체. IHC 및 ICC 등 다양한 응용에 적합. 정제된 PrEST 항원을 사용하여 친화도 정제됨. RNA-seq 데이터 기반의 직교 검증 완료. 40% 글리세롤 및 PBS 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042666-100 Anti-GAPDHS Antibody, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042666-25 Anti-GAPDHS Antibody, glyceraldehyde-3-phosphate dehydrogenase, spermatogenic 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GAPDHS Antibody
Anti-GAPDHS Antibody
Target: glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) — Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human GAPDHS.
Alternative Gene Names
GAPD2, GAPDH-2, GAPDS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glyceraldehyde-3-phosphate dehydrogenase, spermatogenic |
| Target Gene | GAPDHS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000061099 (75%), Rat ENSRNOG00000021009 (75%) |
Epitope Sequence:
KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



