
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GAL Antibody
상품 한눈에 보기
Human GAL 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. GAL-GMAP, GALN 등 다양한 유전자명과 교차 반응 확인. PrEST 항원으로 정제되어 높은 특이성과 재현성 제공. PBS/glycerol buffer에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049864-100 Anti-GAL Antibody, galanin/GMAP prepropeptide 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049864-25 Anti-GAL Antibody, galanin/GMAP prepropeptide 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GAL Antibody
Anti-GAL Antibody
Target: galanin/GMAP prepropeptide
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human GAL protein.
Alternative Gene Names
GAL-GMAP, GALN, GLNN, GMAP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | galanin/GMAP prepropeptide |
| Target Gene | GAL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000024907 (68%), Rat ENSRNOG00000015156 (65%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



