CacheBy
Atlas Antibodies Anti-FZD8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FZD8 Antibody

상품 한눈에 보기

인간 FZD8 단백질을 표적으로 하는 폴리클로날 래빗 IgG 항체로, IHC 및 WB 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터 기반 Orthogonal 검증 완료. 인체, 랫, 마우스 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071142-100 Anti-FZD8 Antibody, frizzled class receptor 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071142-25 Anti-FZD8 Antibody, frizzled class receptor 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FZD8 Antibody

Anti-FZD8 Antibody

Target: Frizzled class receptor 8
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)

Orthogonal validation:
Protein expression verified using Western Blot compared to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against human FZD8.

Open Datasheet


Specifications

항목 내용
Target Protein Frizzled class receptor 8
Target Gene FZD8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000061031 (100%), Mouse ENSMUSG00000036904 (100%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.