
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FUZ Antibody
상품 한눈에 보기
인간 FUZ 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현), ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보. 글리세롤 완충액에 보존되어 장기 보관 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042196-100 Anti-FUZ Antibody, fuzzy planar cell polarity protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042196-25 Anti-FUZ Antibody, fuzzy planar cell polarity protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FUZ Antibody
Anti-FUZ Antibody
Target Protein: fuzzy planar cell polarity protein
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, recombinant expression validation)
- Immunocytochemistry (ICC)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human FUZ.
Alternative Gene Names
- FLJ22688
- Fy
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | fuzzy planar cell polarity protein |
| Target Gene | FUZ |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000011658 (78%), Rat ENSRNOG00000053084 (78%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



