
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-FTO Antibody
상품 한눈에 보기
인간 FTO 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 실험에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA068695-100 Anti-FTO Antibody, FTO, alpha-ketoglutarate dependent dioxygenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068695-25 Anti-FTO Antibody, FTO, alpha-ketoglutarate dependent dioxygenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-FTO Antibody
Anti-FTO Antibody
Target: Fat mass and obesity associated (FTO)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
- WB (Western Blot)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human FTO.
Alternative Gene Names
ALKBH9, KIAA1752, MGC5149
Antigen Information
- Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMP
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000055932 | 79% |
| Rat | ENSRNOG00000011728 | 79% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



